PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P27420_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 346aa    MW: 39454.4 Da    PI: 6.6095
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P27420_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-1887140356
                             --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             k++++t+ q++ Le+ Fe ++++  e++ ++Ak lgL+ rq+ vWFqNrRa++k
  GSMUA_Achr10P27420_001  87 KKRRLTTCQVQFLEKSFELENKLEPERKLQIAKVLGLKPRQIAVWFQNRRARWK 140
                             56689************************************************9 PP

2HD-ZIP_I/II126.71e-4087176291
             HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                             kkrrl++ qv++LE+sFe e+kLeperK ++a+ Lgl+prq+avWFqnrRAR+ktkq+Ekdye+Lk++ydalk ++++L ke+e+L+
  GSMUA_Achr10P27420_001  87 KKRRLTTCQVQFLEKSFELENKLEPERKLQIAKVLGLKPRQIAVWFQNRRARWKTKQIEKDYESLKSSYDALKMDHDSLVKEKEDLK 173
                             9************************************************************************************** PP

             HD-ZIP_I/II  89 eel 91 
                             +e+
  GSMUA_Achr10P27420_001 174 AEV 176
                             987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.14E-1976144IPR009057Homeodomain-like
PROSITE profilePS5007116.64982142IPR001356Homeobox domain
SMARTSM003891.3E-1785146IPR001356Homeobox domain
CDDcd000861.04E-1587143No hitNo description
PfamPF000461.3E-1587140IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-1889149IPR009057Homeodomain-like
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
PfamPF021838.8E-17142183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MVGKRHHGSS NMAVLLQSQG MYKEFSGPLF APGTPSSGSL GSASGSWSLA DLKDGHGNSL  60
ERPLFRPVEL DEIGDDDSGE YPHQPDKKRR LTTCQVQFLE KSFELENKLE PERKLQIAKV  120
LGLKPRQIAV WFQNRRARWK TKQIEKDYES LKSSYDALKM DHDSLVKEKE DLKAEVLSLT  180
KRLLKEENGS LESFEPKRLP DNLQNLDSTL AFEVKKLHGQ TMLCKQEDIS SANSAILDSE  240
SPHHTHEGDC SMLMELNSYS NAFRLDHSDH SQIGDVDDVK HCNFLSPEDT SCGSEFHVAE  300
QIYTGTLSMS CKRWSCPICH KTLDGFHTFF FPLWRKHVDL YYRNRC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134142RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381162.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X2
TrEMBLM0RLW60.0M0RLW6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P27420_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16055714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.18e-44homeobox 1